 |
 |
   |
|
| Alzforum Home Active Topics Email Notify Search Help Register Login |
| Antibodies | |
 Alzforum Bulletin Boards : Desperately Seeking : Antibodies |
Topic: Requests Prior to March 2007( Topic Closed) |
  |
| Author | Message |
|
Antibodies Moderator
Posts: 12 |
 Topic: Requests Prior to March 2007Posted: 08 Mar 2007 at 4:27pm |
|
PLEASE NOTE: To reply to any of the postings to this Topic, "Requests Prior to March 2007," please contact:  Q. I am trying to find the following presentation: Aisen,
P. Mehran, M et al.: Clinical data on Alzheimed after 12 months of
treatment in patients with mild to moderate Alzheimer's disease.
Presented at the 9th International Conference on Alzheimer's Disease
and Related Disorders. July 18, 2004, Philadelphia PA. I am willing to
pay to have a copy. Thank you for your help and cooperation. Penny
Philpot—Posted 25 February 2007
Q. Hi, I am searching for an antibody against Br-cadherin
(also called cadherin 12 or neuronal cadherin-2). This antibody should
be suitable for immunohistochemistry and react on human tissue.
Thanks, Mihovil—Posted 25 February 2007
Q. Hi! I am trying to block Cdk5 expression in primary neuronal
cultures by RNA intereference, using Dharmacon smart pools and
oligofectamine but without great success. Does anybody have any suggestions/protocols???
Q. Hi, I have difficulties with the DsRed Polyclonal Antibody
(#632397) from BD Biosciences on cryosections: I get a very unspecific
staining, but my positive control is fine. For further information: I have
only 1-2 copies of the dsRed transcript (knock-in). What are your
experiences with that antibody? Would/can you recommend any other dsRed
antibody that is working on cryo sections? Q. I am searching for an antibody against presenilin-1. This antibody
must be human specific and must not react with mouse material Q. Hi, I'm looking for a monoclonal antibody against the terminus
of either alpha-secretase product, i.e. 1-16 or 17-42. The antibody must
not cross-react with full-length beta amyloid 1-42 or APP. If you have
ever heard of such a thing, please let me know
Q. I am desperately looking for an m266 antibody to apply in primary
neuronal cultures. Does anyone know if it is commercially available or how
could I get it otherwise?
Q. I am in need of endothelial nitric oxide synthase polyclonal
antibody raised in rabbit or mouse against bovine.
Q. I am desperately seeking a specific antibody for the protein
sAPPalpha (secretory product of APP protein and a product of alpha secretase enzyme).
With reference to literature "Rene etal., 2004, Therapeutic effects of
PKC activators in Alzheimer's disease transgenic mice, PNAS 101(30)", I was
aware of the monoclonal antibody 6E10 to detect sAPPalpha.
Please let me know at the earliest, it would help to purchase the antibody for my experiments.
Q. Dear AD reseachers, to validate our recent studies of FAD mutations in presenilins and ER Ca
signaling (Tu, H. et al. (2006) Cell 126, 981-993) we would like to
perform experiments with fibroblasts from human PS1 and PS2 FAD patients. Q. I'd like to buy the antibody against PS2 N-terminal from
Alexis (monoclonal antibody to presenili 2 (APS 21) ) for western blotting.
Does anybody know if it is a good antibody?
Q. Does anyone know of antibodies that specifically recognize
Abeta n-38? How about anti-P3? (must be selective in each
case for the species noted)
Q. Hi. I'm looking for a good antibody against mouse presenilin 2
N-terminal for western blot!
Q. Hi! I'm desperately looking for the cell line named 7PA2 (CHO
cells) and I would be very grateful if you could either provide me with a
vial or if you'd know where to purchse them from.
Q. Does anyone know of a commerical source for monoclonal
antibodies against IAPP (amylin)?
Q. I'm looking for purified neuron-axon filament protein (NAFP).
Q. Hi all, I'm looking for the 3D structure of monoclonal antibody
raised against abeta(1-42). If possible, Please send me the 3D strcuture of
this abeta immunoglobulin structure in .pdb format.
Q. Please, could you send me information about coss-reactivity for
measurements of chromogranin-A, RIA in pig serum or plasma.
Q. I am looking for a few brain tissue samples for alzheimer's to
aid my research. Is there anybody out there who can help me procure some? I
think I have found something quite relevant but I need some more
samples to confirm it.
Q. I am currently seeking antibodies that will recognise mouse VEGF
isoforms (188,164 and 120) on a western blot. Any info will be
greatly appreciated. I have tried a couple of different antibodies
to date and can only see 164.
Q. We are desperately seeking somebody who works with recombinant
alpha-1-antichymotrypsin as we have projects running but no more
rACT. Please, if you can spare some ACT contact me.
Q. Hi, I am looking for an antibody against rat brain Cyp46 (CHOLESTEROL 24-HYDROXYLASE) for Westerns and ICH.
Any suggestions are welcome!!!
Q. Hi, I am looking for an antibody to detect the C terminal tail of presenilin
(using as an inmunogen the few terminal amino acids).
I've tried with P7854 from Sigma, but it didn't work well. Does anybody know where can I find a good antibody?
Q. I am looking for an antibody to selenoprotein S. It is a surface protein of the ER,
and is involved in the processing and removal of misfolded proteins.
Q. Hi. I'm looking for an antibody (for western blot and
immunohistochemistry) aganist human 17β-hydroxysteroid dehydrogenase
type 1and 2 . I would appreciate it if any one could let me know if
there is any source for these antibodies. Q. Hi. I am seeking antibodies to ptpn21 and Nrg3, both Human.
Q. Hi. I am looking for a monoclonal antibody specific against the so-called A-beta globulomer
(a 12-mer molecule generated by incubation with –of all things- SDS!!).[Ref: J Neurochem, 2005, 95, 834-847].
Does anyone work with/on this type of oligomeric form of A-beta? If anyone does have this oligomeric form,
can you please tell me how to generate it from the monomeric form? I have tried it but can’t get a clean band on the gel.
Q. Hi. I'm looking for an ELISA kit for rat's CSF melatonin.
Q. Hi. I am looking for an antibody against mouse or human Huntingtin gene for this region of the mouse genome:
HNHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGF VLKQFEYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASG
Q. Hi. Does anyone know a commercial source of polyclonal antibodies to melatonin. I need these antibodies
for immunohistochemical studies in the mouse.
Q. Hi all. I am looking for anti chicken ovalbumin antibody which I can use for Facs analysis.
If someone knows anything about it the help is very welcome.
Q. Our lab is in need of monoclonal DsRed antibody.
We have tried to buy some from clontech, but it has been on backorder for the past two months.
If anyone could send us a small aliquot, we could replace it when we get our order.
Q. I'm working on a project with protein AIPL1, but I don't have the
antibody. I would appreciate if anyone can give me some information
were can I get it.
Q. I am looking for an antibody that recognizes residues 23-29 of beta amyloid
(sequence DVGSNKG).
Q. Hi, I am looking for a reliable antibody for the detection of HMG-CoA reductase in WB. Thanks for the help.
Jakub Golab, M.D., Ph.D. Q. Hi, I would like to try some anti-phospho-tau immunostaining on parafin-embedded mouse tissues. Would anyone have specific ordering information for Innogenetics? Their AT8 antibody seems to be the most popular. Thanks for any help. Steve Crocker—Posted 9 December 2005 Q. Hi, I would be highly thankful if somebody could provide us with Amyloid beta specific oligomer
antibody for detecting/quantitating invitro oligomers formed in presence of our test molecule. Thank you. Veer Bala Gupta Q. Hi, I am about to complete a set of experiments for which I need
anti-phosphoserine 880 GluR2 antibody.
This antibody is not commercially available anymore. Has anybody got any?
Q. Hi! I am begining to work within this subject and would like to
know how to handle gamma secretase inhibitors such as L685458,
commercialized by SIGMA. Is it reliable to resuspend it for example in PBS
and freeze it at minus 20? for how long? is it stable?
Q. I would appreciate it if someone could give us antibodies for detecting phosphorylation dependent
and independent forms of Tau and of senile plaques. This is basically to do our pilot studies in a mouse model that is
deficient in phosphatase but shows neurofibrillary tangles and senile plaques. We wish to check whether the observed
NFTs are phosphorylated Tau or not.
Q. We want to see if a new compound can target on RAGE. We need the plasmid full-length RAGE (RAGE-FL) and the RAGE
cytoplasmic deletion mutant (RAGE-Δ). Can someone help us, and send these plasmids and their antibodies?
Q. I need reliable antibodies to two postsynaptic proteins: PSD-95 and GABA-A alpha subunit. And if someone has
a good idea for another postsynaptic protein I would like to interchange protocols.
Q. Has anyone ever seen a reduction of amyloid plaques in
mice after a SHORT (1 month or less) immunization? (Could you provide a
reference, please? ) Q. I'm doing a masters thesis about rheumathoid artritis! I'm going to do
ELISA to investigate ferritin! Could you recommend to me some reliable antibodies to L- and
H-chain ferritin, please?
Q. I'm looking for the famous 12E8 antibody against tau phosphorylated
at S262, in KXGS motif. Does anyone know if it is commercially available
or how could I get it otherwise? Q. I would like to know if there are commercially available human and mouse chitinase-1 chintinase-2 antibodies?
Q. I'm looking for an antibody that will on Western Blot pick up
neurofilament M in mouse tissue that is specific for the phosphorylated form of the protein.
If you are aware of some place I could purchase this antibody, please reply. Q. I'm looking for anti human presenilin 1 antibody with epitope located between 105-280 AA residues
( between first transmembrane domain and putative site for 'presenilinase' activity ). Q. I’m interested in working with the IGFBP3 antibody from Gene Tex
(product id = 16328),
but I need some more information about how/ if it works in Western blotting and eventually immunoprecipitation.
Has anybody already used it and could ensure me that it really works? Q. I am using OBTOO30-Monoclonal Rat -anti-BrdU (as primary antibody) on
mouse brain. The pregnant mums or animals were injected with Brdu in
vivo and then their embryos were processed for paraffin. I am not
getting any results and I think this is because of the primary antibody
(OBT0030). Is it the right antibody for this kind of experiment? Q. Does anyone know of a good rabbit antibody to ApoE in mouse tissue that
can be used for immunohistochemistry? Q. I am looking for an alpha7 beta integrin that reacts to mouse
myoblasts. I will use it for flow cytometry and hopefully it is conjugated to a flourochrome. Could someone help me out? Q. We are desperately seeking for Amyloid AA antibody that would work on
Western blots and immunohistochemistry in mouse tissues. Q. Does anyone have experience with unfixed (frozen only) brain samples and alpha synuclein antibodies?
I have problems detecting the antigen in this tissue. Could someone help me out and get in contact with me? Q. Dr. Sergiu Calmanovici advises that he has created a new antibody, 480 Tamra, which produces, in various animal models, neuropathology that is indistinguishable from Alzheimer's pathology. Limited amounts are available. Contact Sergiu for more information.—Posted 8 July 2005 Q. I am looking for a human kalikrein 6 (neurosin, protease M) antigen (native or recombinant protein) for calibration
of my ELISA method. Does anybody know where I can buy this antigen? Does anyone out there donate any such protein, preferably
commercial, or generated (purified) by individual researchers? Could someone help me out? Any info would be greatly appreciated. Q. I need an anti-ovalbumin antibody for research use. I
wonder which companies have this kind of product? Q. I am looking for information regarding the availability of F(ab')2 fragments of 3D6, and techniques on how to
label antibody with dye. I really appreciate any response.
Q. I am doing my PhD at the Hacettepe University, Faculty of Medicine,
Department of Medical Biology, Ankara, Turkey. I am searching for an
antibody that is specific for human ST6Gal1. I learned that it is not
commercalized yet. I will be grateful if anyone could help me! Q. I am looking for an antibody that recognizes Ser 159 phosphorylated Cdk5.
I know that Santa Cruz biotechnology has one already, but I need to try one other from a different supplier.
Does anyone know if any other company supplies the same...? Q. I need an ab for immunocytochemistry for Dax1/NROB1 in mouse, rat and
human tissues. Can anyone recommend any commercial one?
Q. We are desperately seeking for anti-ApoE Ab that would work on Western blots with RAT brain proteins,
We had no success with Calbiochem Abs. Q. Has anyone had any success in using Chemicon's MAB348 (formely Roche
22C11) to cause neuronal toxicity in the last year or so? We have tried
three different lots of this antibody and have not been able to see the
same effect on neuronal death that we and others have published when
using the 22C11 from Roche. Q. I need an antibody directed against poly-alanine repeats. Does anyone know
if one exists and if so where I can get it from? Any info would be greatly appreciated. Q. We are looking for an anti-sAPPbeta. Would you please give us some help? Q. We are looking for an anti-OVA (chicken egg ovalbuimn) antibody that can be used in Immunofluorescence (IF) applications.
We can pay the shipping ! Q. I am a scientist from EnVivo Pharmaceuticals. I am asking if people know any immunostaining protocols for anti-Abeta42
antibodies without using formic acid treatment. Q. I wish to contact other researchers who have, and
would be willing to send me, an APP gene . I wish to make Tg mouse
expressing this gene.
Q. If anyone has a staining protocol for KMn04 congo Red for AA and AL amyolid I sure would like to have a copy of it. Q. I am looking for anti-rat C5a and serum amyloid A. An ELISA kit would be even better. Q. I am looking for paravulbumin antibody; is a Ca2+ binding protein, is excellent new neuroanatomical markers which
can be utilized to selectively visualize certain neurons and pathways in CNS. Q. I am desperately seeking phosphorylation-independent
neurofilament H antibody that stains NFs well in formaldehyde fixed
cultured neurons (using immunofluorescence) with no cross reactivity
with M or L. I tried some commercially available antibodies from Sigma
and Chemicon but none of them worked for my purpose. Q. I wish to contact other researchers who have, and would be willing to send me, a Thy-1 promoter construct.
I wish to make Tg mouse using this promoter. Q. We are desperately seeking HMG-CoA reductase antibodies. We will pay shipping! Q. I am looking for IgG from rhesus monkey serum, should be 95% essentially
salt free (SDS-PAGE or HPLC). Please let me know if you have some available for immediate use. Q. I am desperately seeking antibody raised against SEVKM (666-670) residues of
APP corresponding to C-terminus of sAPP-beta. Q. I wish to contact other researchers who have, and would be willing to send me, an APP promoter
construct. I wish to carry out a luciferase reporter assay using this promoter. Q. I need a TrkA negative cell line.
From the literature I found SK-N-MC, IMR-32, CHP134, IMR5. I ordered
SK-N-MC but it was not negative for both transcript and protein. Is there
any other well known cell line tested/used/known to be used as a TrkA
negative control? A. The following paper might be helpful to you: Q. I am searching for a 10D5 antibody to amyloid
for testing rabbit brain beta-amyloid. Please tell me if you know of one. Q. I am seeking antibodies for detection of PS1, GAP43 and/or Kif5b, mainly
by immunocytochemistry and if possible also by western blotting.
Hopefully is there anybody who has experience with these antibodies I need and eventually
spare some to test them in my cells. Any information would also help a lot. Q. I am a biochemistry PhD candidate and I want to produce a mAb against melatonin.
I would apreciate if you kindly let me know about production, application and availabilty of this product in the market. Q. I am despartely seeking an APC conjugated gamma delta TCR antibody for
staining murine thymocytes, does anyone know of a source? Q. Does anyone know of a corporation that sells diagnostic Kit for Luteinizing Hormone (Colloidal
Gold) for a moderate price? Q. I'm desperately seeking antibodies to detect selectively Ab 1-40 and Ab 1-42,
by western blotting and immunocytochemistry. The antibodies we had used at the lab are A-8326 (by SIGMA)
wich has a weak detection by western blotting and the other one is an anti-human amyloid b 1-42
by Pharmingen (BD Biosciences) which is supposed to be suitable for immunocytochemistry but we've had poor results with it
and it definitely doesn't work in western blot. I really need advice in this matter and, even better, I hope that some one
could spare some good antibodies.
Q. I am writing to ask for your help. I am studying for a Master's degree in neuroscience in Wuhan University in China. Q. I am looking for an antibody to beta-Amyloid 1-40/42(10D5)
for testing beta-Amyloid in rabbit brain.
Q. I am looking for an antibody that recognizes human RIL protein.
Anti-human TRIP6 antibody will also be extremely helpful. Q. For my ELISA I am searching an
HRP-labeled antibody that can recognize the part of APP before the beta
cleavage site (so recognise sAPPbeta). Does anybody know where I can buy such an antibody?
Q. I am looking for any information on polyclonal, preferably rabbit, antibodies to polyglutamine.
Has anyone had one of these or any experience in trying to generate one?
Q. I am looking for an antibody to the intravesicular/extracellular domain (amino-terminal
epitope) of mouse/human APP that does not cross-react with APLP1 or APLP2. It should work
great in immunocytochemistry and immunohistochemistry. Ideally, it should be a mouse
monoclonal antibody. Q. If anyone out there knows where I can purchase m266 for a good price, I
would really appreciate it. Q. I am looking for an ELISA for secreted sAPPalpha / full length APP. Q. I am looking for a monoclonal antibody that recognises mouse
presenilin 2. Q. I am seeking rat apo-A1 and an antibody against rat apo-A1. The antibody may be raised in mouse,
rabbit, horse, dog, pig, etc. Q. I am looking for an antibody to LBPA (lysobisphosphatidic acid). I prefer
a monoclonal antibody that recognises the LBPA. Q. I'm looking for an antibody (preferably monoclonal) that recognises the human FE65 factor.
Q. We are looking for Ab's suitable for western blots that target enzymes in the lipogenic,
lipolytic, gluconeogenic and ketogenic pathways.
If anyone could help with possible sources we would appreciate it.
Q. I am looking for an ELISA to measure ADAM 10 protein levels and an assay
for ADAM 10 activity in human brain extracts Q. Hello, I need to get some information regarding
immunohistochemistry of 11beta Hydroxysteroid Dehydrogenase Ezzyme. What
antibodies and technique could be used? Q. Can anyone provide me some information on how to
find the NF-M purified protein (human) since I want to use it as my western blotting positive control!
Q. We have just purchased some Merck GFAP, NFKB antibodies but there is no data available for the use of the
antibody for immuohistochemistry. Could anyone let me know if they have used it for this purpose and if so could they provide me
with protocol regarding the fixatives and concentrations for LM and or TEM using fluorescence and immunoperoxidase
detection systems? Q. I am looking for an antibody specific for polyglutamine oligomer that does not recognize monomeric polyglutamine.
Could someone help me out? Q. I am looking for an antibody directed against the c-myc epitope used as a tag, obtained from a
different species than mouse or rabbit. Q. I am desperately seeking monoclonal antibodies raised against EFRH (3-6) residues of N-terminal A-beta peptide with
IgG2a and IgG2b isotypes. Q. I have been seeking an antibody to anti amyloid domain (for e.g KLVYA) in beta amyloid and amylin,
in order to look at its inhibition state. Does anyone out there donate any such antibody, preferably commercial,
or generated by individual researchers? Q. Does anyone know of a corporation that sells 4G8 crude for a moderate price? Q. We are looking for an anti mouse Abeta antibody for the pursuit of brain immunoblot and/or
ELISA experiments with NON-APP transgenic mice. Q. I am looking for an antibody specific for Abeta oligomer that does not recognize Abeta monomer. Could someone help me out?
Q. I am looking for an antibody recognizing MOUSE serum amyloid A, ideally raised in rabbit or goat. Q. I am looking for an ELISA kit for measuring APP in rat brain extracts. Q. I am looking for a company that makes an ELISA kit for measuring APLP1. Q. I am looking for an antibody specific for GFAP (rat) for ELISA but done on the untouched cells
after fixation and permeabilisation. Can anyone help with protocol and where to get antibodies. Q. I am looking for a monoclonal anti-mouse APP CTF antibody that can be used
on Western blot. Can anyone help me out? Q. I am looking for an antibody specific for the Amyloid intracellular domain
(AICD) without detecting any other C-terminal fragments (ie antibody against
aa 49-60 of APP, numbering from the first residue of Abeta). Could someone
help me out? Q. We are currently looking for recombinant sAPPbeta'. I.e. secreted APP that
is derived from full length APP processed by BACE at the Glu11 position
(sAPPbeta+ amino acids D A E F R H D S G Y). Can someone inform us where to
buy this recombinant protein. Q. I need an antibody that CAN distinguish the NFkB p105 form and not the p50. Q.I am and have been desperately seeking an antibody to phosphorylated
fyn, in order to look at its activation state. Does anyone out there
know of any such antibody, preferably commercial, or generated by
individual researchers????? Q. I am looking for human or murine Myostatin cDNA. Please inform me
where I can buy them or get them. Q. I am looking for an antibody to melatonin receptor 1/2. Does anyone know
a commercial supplier or lab producer? Q. I need to find an antibody to cdx-2 that works very well in
immunohistochemistry on paraffin sections. Q. I am seeking a kit to detect Bovine Il-1beta, can anybody help please? Q. Has anyone used 4G8 or 6E10 in flow cytometry? If so, can you recommend the best commercial supplier
of the antibodies for this purpose, and are they available fluorescently labeled? Q. I would like to use monoclonal antibodies specific for beta amyloid, clone Nos. 3D6 and 21F12.
I'd appreciate if anyone would inform me of the commmercial sources. Q. Can anyone recommend an antibody against the N-terminal of human APP that
can be used in an ELISA? Q. Has anyone ever tried 4G8 or any other ABeta in adult guinea pig brain by
immunohistochemistry? The only published record of any AD type pathology in
GP brain dates from 1910 (Perusini) - surely someone has looked in the last 97 years. Q. I am looking for an insulin antibody measuring kit, i.e. human insulin measured
in rat (after dosing with human insulin). Are there ELISA kits for quantitating insulun antibodies? Q. For a trial on differentiating mouse embryonic stem cells I am looking
for an antibody against Neurofilamen 68 kDa (NF-L). If anybody could share some AB
with me I would greatly appreciate it. Q. We have just purchased some Bachem Guinea-pig Galanin antibody but there is
no data available for the use of the antibody for immuohistochemistry.
Could anyone let me know if they have used it for this purpose and
if so could they provide me with information regarding the fixatives
and concentrations for LM and or TEM using fluorescence and
immunoperoxidase detection systems? Q. I am looking to buy an anti-alpha 7 integrin antibody that cross-reacts ?ith human tissue.
The mouse reactive version, clone 6a11, is commercially available now but does not react with human. Help! Q. I am looking for antibodies which can stain endogenous Presenilin-1 in mouse IHC. If you know the sources (either commercially available or the labs), please drop me a line. Thanks, Yonghua Pan—Posted 2 April 2003 Q. I am looking for a non-Rabbit mAb against p35. Thanks, Othman Ghribi—Posted 20 March 2003 Q. I am a graduate student working for my Ph.D. I am in need of antibody for the A beta region of Amyloid precursor Protein. I will be using the antibody for my western blotting studies in mice tissues. Can anyone provide me a small aliquot. I will acknowledge the kind help whenever necessary Thanks, T. Mani—Posted 19 March 2003 Q. In my IP and western-blot experiments about APP, I find that
there are many bands recognised by APP N-ternimal and C-ternimal
antibodies. I can't comfirm what the types of these bands really are. Who
can tell me
Q. Does anyone know which company or lab could supply me with the 8E5 antibody for APP? Thanks, Julia Kellersmann—Posted 13 March 2003 Q. We are planning to produce Fab fragments of an antibody against
the C-terminus of sAPPalpha (equivalent to N-terminus of Abeta).
As we could not find any report of Fab fragments of a suitable
antibody (only of 4G8, which does not serve) in the literature, we
are somewhat apprehensive, because there is the possibility of
papain destroying the antigen-binding site. Has anybody done this with 6E10?
Q. I am looking for an antibody capable of detecting by
immunocytochemistry epitopes in the mouse APP region corresponding to
the amino-terminus of the A beta peptide. Does anyone know of an
antibody similar to the 6E10 antibody (recognizes the first 17
amino-terminal amino-acids in human Abeta) that would work with mouse
APP? Thanks, Virgil Muresan
Q. I am research scholar looking for a laboratory that can spare a small amount of abeta antibody (recognize both the abeta 1-40 and 1-42 in rat cell lines), working in immunocytochemistry and Western blotting (astrocytes and glial cells). Thanks, Jayaraman Murali—Posted 1 March 2003 Q. I'd like to find out if?there's a commercial supplier of antibodies to serum cleaved Tau (C-Tau) similar to the ones used by Zemlan's group. I'm interested in using them for both ELISA & Westerns. Thanks, Alice Loo—Posted 28 February 2003 Q. Can anybody recommend to me a commercial or laboratory source for GFAP and its antibodies? Thanks, Louis F M Campos—Posted 24 February 2003 Q. Can anybody tell me which company or lab could supply me with the two antibodies used in western blot and immunohistochemistry: Ab against human alpha-synuclein and Ab against rat alpha-synuclein? Thanks, Tong Liu—Posted 18 February 2003 Q. Does anyone have a comercial or laboratory source for glypican 3 antibody useful in cell sorting? Thanks, Please contact Miki Blumenberg—Posted 10 February 2003 Q. I am looking for an antibody against galanin that is raised in an animal
other than a rabbit, for immunohistochemical studies. If anyone is aware
of a commerically or privately available antibody I would be greatful if
they could contact me. Dr Susan E Luff Q. Do you know if there are commercially available kits for beta-catenin and GSK-3 beta? Many thanks and kind regards, Pierre—Posted 3 February 2003 A. For antibodies I would suggest that you purchase the antibodies from commercial sources. The most reliable antibodies to beta-catenin and GSK that we have used are from Transduction laboratories (now owned by BD Biosciences I believe) and Upstate biotech. Upstate also sells purified protein, like GSK. Finally, we buy the phospho-specific catenin antibodies from Cell Signaling (from New England Biolabs). Edward Koo—Posted 4 February 2003 Q. Is there a commercially available antibody that immunoprecipitates both Ab40/42? Is the 1E8-4b or similar clone about? I need this ab to wrap up my PhD. Thanks, David Anderson—Posted 3 February 2003 Q. Does anybody know which MW for APP I should expect by using MAB348 from Chemicon (clone 22C11) and MAB343 (still from Chemicon) in Western blot? I use mouse embryonic cells transiently overexpressing human APP751. And in your opinion which is the best antibody to detect human APP and Abeta1-42 in the same kind of cells? Thanks in advance, Fulvio Celsi—Posted 29 January 2003 Q. Is it possible to use FLIP as an inhibitor of the FAS pathway, does anyone know whether there is commercially available FLIP which will enter cells and inhibit. Alternatively, how can we inhibit specifically the FAS pathway? Thanks, Brendon Noble—Posted 20 January 2003 |
|
 IP Logged |
|
| |
||
Bulletin Board Jump |
||
